PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009597017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 342aa    MW: 39409.2 Da    PI: 5.5167
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009597017.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.43.8e-55111401129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv +yL+kk++++k++l +vi+++d+y++ePwdL+ k    ++e+kewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v
  XP_009597017.1  11 VPPGFRFHPTDEELVGYYLRKKIAAQKIDL-DVIRDIDLYRIEPWDLQdKcgIGYEEQKEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAV 104
                     69****************************.9***************943543334778************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     ++ k++l+g++ktLvfy+grap+g+k+dW+mheyrle
  XP_009597017.1 105 YD-KSKLIGMRKTLVFYRGRAPNGQKSDWIMHEYRLE 140
                     **.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-607160IPR003441NAC domain
PROSITE profilePS5100559.09911160IPR003441NAC domain
PfamPF023651.2E-2812139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MMDTNESSSC VPPGFRFHPT DEELVGYYLR KKIAAQKIDL DVIRDIDLYR IEPWDLQDKC  60
GIGYEEQKEW YFFSHKDKKY PTGTRTNRAT MAGFWKATGR DKAVYDKSKL IGMRKTLVFY  120
RGRAPNGQKS DWIMHEYRLE SEENTLPQEE GWVVCRAFKK RNTGQAKTNI NGEGWESNYF  180
YEESSGVSSV VDPLEYIPRQ LPTGNFMSQN LLCKQEIEGN NNSSLIFLHS DQFVQLPQLE  240
SPSLPLMKRP SSMSLISEDD QQITKRSKID KNINDRVTDW RALDKFVAYQ LSHDDGVSSY  300
EPHNGSDLGM LLLQSGREEG PKLDDFLSST SNRDIGICIF DK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-50616210170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597016.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_009597017.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9SL411e-155NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A061DFT41e-179A0A061DFT4_THECC; Vascular related NAC-domain protein 1 isoform 1
TrEMBLM0ZVN61e-179M0ZVN6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000091361e-178(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-145vascular related NAC-domain protein 1